DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yin and SLC15A5

DIOPT Version :9

Sequence 1:NP_001284844.1 Gene:yin / 31340 FlyBaseID:FBgn0265575 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001164269.1 Gene:SLC15A5 / 729025 HGNCID:33455 Length:579 Species:Homo sapiens


Alignment Length:535 Identity:123/535 - (22%)
Similarity:207/535 - (38%) Gaps:119/535 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALIADGWLGKYKTILYL 144
            |.||||.::.:...::.:.|.||||:...|.:|...|.....:.|:....:.|.:||:.|.:...
Human    50 ELCERFTFFEVVCNMIPFCTIKLGYHNCQAAILNLCFIGTSILTPVFVRWLTDVYLGRNKLVYIC 114

  Fly   145 SLVYSLGAMVVSFGAVPL-----------SGMP---TKAVTVVGLLLIAIGTGGIKPCV---SAF 192
            ..::.||..::|..|.||           :.:|   ...:..|.||.|.:|.||::..|   .||
Human   115 LFLHFLGTALLSVVAFPLEDFYLGTYHAVNNIPKTEQHRLFYVALLTICLGIGGVRAIVCPLGAF 179

  Fly   193 GGDQFSLPAQSFQLAKFFSLFYFAINAGSLISTTFTPILRADVHCFGDQDCFSLAFGVPAILMIF 257
            |..::.    |.:...||:.||:.:|..:       .|:...:........::|...:|.:.|:.
Human   180 GLQEYG----SQKTMSFFNWFYWLMNLNA-------TIVFLGISYIQHSQAWALVLLIPFMSMLM 233

  Fly   258 SVI---------IFMAGKRLYRCQPPAGNMIFGVSRCIADAFKGW--QKRRHSEPMESFLDYAKP 311
            :||         |:.:.|   ||     :::.||. .:..|.|..  |.......:.|.||:||.
Human   234 AVITLHMIYYNLIYQSEK---RC-----SLLTGVG-VLVSALKTCHPQYCHLGRDVTSQLDHAKE 289

  Fly   312 TVG---SRM-VQETKCLGRILRLFLPFPVFWALFDQQ-GSRWTFQATRMDGNVLGFQIKPDQMQV 371
            ..|   |.: |::|.....:|.||: |.:.:.:...| .|.:..|....:.|:.||.:....|..
Human   290 KNGGCYSELHVEDTTFFLTLLPLFI-FQLLYRMCIMQIPSGYYLQTMNSNLNLDGFLLPIAVMNA 353

  Fly   372 VN--PLLILG-FLPLFDYIIYPA------LARCGIRRPLQKLTLGLLLAALGFFLSAGLEMKMEQ 427
            ::  |||||. ||..|...::|:      |:.|        :..|.|.|||...::...|:..:.
Human   354 ISSLPLLILAPFLEYFSTCLFPSKRVGSFLSTC--------IIAGNLFAALSVMIAGFFEIHRKH 410

  Fly   428 AAYRATPIEPDMTHLRIYNGMPCRYEISSAVVQTPRVIEPLNVWEDLSLQMTESKEYTFNAQPVS 492
            ......|:...:..:   :.|||.|.|...|:        |.|.|.|.........|.|      
Human   411 FPAVEQPLSGKVLTV---SSMPCFYLILQYVL--------LGVAETLVNPALSVISYRF------ 458

  Fly   493 GECPSIIDKLRLQPGKSVSYFLAQDKLVEFADGLQMAATDTGRTSVRALLNTPDGEGPVLLSTES 557
              .||.:      .|.|:::....:....|          ||...|:.:....||..        
Human   459 --VPSNV------RGTSMNFLTLFNGFGCF----------TGALLVKLVYLISDGNW-------- 497

  Fly   558 ATSQEPPLTLDKGNV 572
                 .|.||:|||:
Human   498 -----FPNTLNKGNL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yinNP_001284844.1 2A1704 85..719 CDD:273343 119/530 (22%)
MFS 138..>398 CDD:304372 71/301 (24%)
SLC15A5NP_001164269.1 MFS 139..493 CDD:304372 91/417 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D365203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X63
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.