DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT1G65200

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_176699.1 Gene:AT1G65200 / 842827 AraportID:AT1G65200 Length:1101 Species:Arabidopsis thaliana


Alignment Length:251 Identity:57/251 - (22%)
Similarity:98/251 - (39%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LASGPLAGRRFPLGCLGDAAECFELLLHRVHSHISPDDGDSCESSACIAHRRFAMRVIEQSVC-K 229
            |.||.||..........||||....:|.......||..    ||   :..|.|.:...|:..| |
plant   864 LLSGLLASLEEVHSMSNDAAEVVIAILEFWQCWKSPQR----ES---LVTRLFTLEEYERMKCSK 921

  Fly   230 CGANSEQLP-FTQMVHYVSASALTSQKSLALQSHQQLSFGQLLRAAGNMGDIRDC---PNTCGAK 290
            |    .::| :.:...|....|..|.:.|.. :...:.||.:::.. .|.|...|   ...||..
plant   922 C----RKMPNYPEQRSYGVVIAADSIRDLKC-AFGNIKFGDIIKVI-RMEDKMLCDIKTRGCGKA 980

  Fly   291 IGICRALLNRPEVVSIGIVWDSERPAADQVHAVLKAVGTSLRLGDVFHQVSEPRWAQQTQHELVG 355
            ..:...:.:.|.:.:|.:.|: :.....::...|||:...:.:..::..: ||    .|.:.||.
plant   981 NFVRHTISSCPPIFTIVLKWE-KNETEKEISGTLKAMDWEIDISKLYEGL-EP----NTNYRLVS 1039

  Fly   356 IVSYYGKHYTTFFFHTKLKVWVYF-DDANVKEVGPSWEGVVDKCSRGRYQPLLLLY 410
            ::. .|:.........|...|:.. .:|.::||...|:.||..|...|.:|.:|.|
plant  1040 MIG-CGEEGEYICMAYKKNRWISLRHEALIEEVVGIWKSVVRFCGERRVRPEILFY 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072 51/232 (22%)
AT1G65200NP_176699.1 DUF627 17..122 CDD:282615
DUF629 179..639 CDD:282614
UCH 804..1094 CDD:278850 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.