DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT1G65140

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_176693.4 Gene:AT1G65140 / 842821 AraportID:AT1G65140 Length:319 Species:Arabidopsis thaliana


Alignment Length:195 Identity:33/195 - (16%)
Similarity:84/195 - (43%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 FAMRVIEQSVC-KCGANSEQLPFTQMVHYVSASALTSQKSLALQSHQQLSFGQLLRAAG-NMGDI 280
            |.:..:.:::| :|..:......|.....::|::|...||    :.::.:|..:::|:. |:..:
plant   120 FEVNEVAKTICIRCKTDMAYSGETSYGIIINANSLRVYKS----AFKEFTFENIIKASMINVKML 180

  Fly   281 RDCPNTCGAKIGICRALLNRPEVVSIGIVWDSERPAADQVHAVLKAVGTSLRLGDVFHQVSEPRW 345
            .| ...||.:..:...:.|.|....:.:.|::.. ...::......:.|.:.:..::..|.:..:
plant   181 CD-KEGCGKRNYVDTMISNLPSAFIVALQWENNE-TEKEIFDTASVLATEIDISAIYRYVGDSAF 243

  Fly   346 AQQTQHELVGIVSYYGKHYTTFFFHTKLKVWVYFDDANVKEVGPSWEGVVDKCSRGRYQPLLLLY 410
               |::.||.:|..:|..|....:....  ||....:.::.:| .|:||:........:|.:|.:
plant   244 ---TKYRLVSMVWSHGNLYNCVAYENNR--WVRHFCSEIEVIG-DWDGVLRIFRELHIRPEILFF 302

  Fly   411  410
            plant   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072 33/193 (17%)
AT1G65140NP_176693.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.