DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT1G65130

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_176692.3 Gene:AT1G65130 / 842820 AraportID:AT1G65130 Length:1079 Species:Arabidopsis thaliana


Alignment Length:260 Identity:44/260 - (16%)
Similarity:90/260 - (34%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DAAECFELLLHRVHSHISPDDGDSCESSACIAHRRFAMRVIEQSVCKCGANSEQLPFTQMVHYVS 247
            :|||....:|...|...||:       |..:..|.|.:...|:..|:........|         
plant   862 NAAEVLVAILEFCHCWKSPE-------SESLVTRLFTLEEYERMSCRKCRRKPNYP--------- 910

  Fly   248 ASALTSQKSLALQSHQQLSFGQLLRAAGNMGDIRDC-------------------------PNTC 287
                           :|.|:| ::.||.::.|: :|                         ...|
plant   911 ---------------EQSSYG-IVMAADSIRDL-ECALGNIMFEDTLKVIRMNNEMICDVGTGGC 958

  Fly   288 GAKIGICRALLNRPEVVSIGIVWDSERPAADQVHAVLKAVGTSLRLGDVFHQVSEPRWAQQTQHE 352
            |.:..:...:...|.:.:|.:.|:...... :::....|:...:.:..::..: ||    .|.:.
plant   959 GERNLVHHTISRCPPIFTIVLEWEKNETEI-EIYETTNALHWEIDISRLYEGL-EP----NTNYR 1017

  Fly   353 LVGIVSYY--GKHYTTFFFHTKLKVWV-YFDDANVKEVGPSWEGVVDKCSRGRYQPLLLLYAVPQ 414
            ||.::...  |::....:...:   || ...:|:.:||..:|:.||..|...:.:..:|.|...|
plant  1018 LVSMIGCVEEGEYICMAYEKNR---WVSRRHEASAEEVVGNWKSVVKICGERKIRSEVLFYEAVQ 1079

  Fly   415  414
            plant  1080  1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072 42/254 (17%)
AT1G65130NP_176692.3 DUF627 11..119 CDD:282615
DUF629 174..638 CDD:282614
UCH 781..1075 CDD:278850 42/254 (17%)
Peptidase_C19 856..1076 CDD:239072 42/255 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.