DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT1G52430

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_175652.1 Gene:AT1G52430 / 841674 AraportID:AT1G52430 Length:1136 Species:Arabidopsis thaliana


Alignment Length:212 Identity:46/212 - (21%)
Similarity:86/212 - (40%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1105 NLSNLSAMSSNTSISEDSCQTIITTCAQVHSEQSPLKDLQMLVAQDELPLPPPMELPPYPSPPHS 1169
            ||:.|||..:.|.|.:.....::...  ::.|:....|   .||.|   |....|........:.
plant   666 NLARLSAFDNRTYILQLMKPFLLNEI--MNMERKAKAD---AVAAD---LALEEEKKAQSKKKND 722

  Fly  1170 SCHSRQAS-EDFPP-------PPPPELDL--------EPLNQQLSQLQALEAASKQQRQQLESLE 1218
            ..:.::|| ..|.|       .||..|:|        ||.|...|:...||::||.|.|:..:.:
plant   723 KINKQRASMSKFSPLDQTVEHKPPVNLELKTVEEDSMEPENALASESGPLESSSKTQNQEEATKD 787

  Fly  1219 GTTSILAQLQQRQHLLKLRKEQANHPGAATTDATWLKELQAKQANDLRAMQRKLEASS------P 1277
            |...:|.  ..::..|....|.|....||..::.  .::..|...:::.::..|:.::      |
plant   788 GPAEMLD--MPKEDSLSAHSESAIGGAAARYNSA--LDMTLKALLNIKVLKEDLKNNTQRFQQVP 848

  Fly  1278 SSVRDLTHRFEQTSIRS 1294
            |:::...:.|...||::
plant   849 SALQHFFNAFVSESIKT 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072
AT1G52430NP_175652.1 DUF627 15..122 CDD:282615
DUF629 188..646 CDD:282614
UCH 808..1091 CDD:278850 10/60 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.