DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT5G51530

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_199966.1 Gene:AT5G51530 / 835227 AraportID:AT5G51530 Length:1149 Species:Arabidopsis thaliana


Alignment Length:268 Identity:53/268 - (19%)
Similarity:90/268 - (33%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 EKLCHEADQLLEKSRLVEESHDLETALVLCNAAAGRAR-----------AAMDAPYSNPHTMTFA 760
            |.||...|:  .:..|:|:..: :.|.:||::...|..           |..|......|. ||.
plant   551 ENLCMSEDE--RRKNLLEDQWN-KYASLLCDSCEERVSENSITANFFLWAVRDVLQGASHP-TFD 611

  Fly   761 RMKHNTCVMRARSLHRRILVEKGAETEAMPELKHMREGSTSSVKHVR------QNSKDRTLEKEQ 819
            .:....|:...|  .|:.|    .:..|:..:.|::...|..|..:.      .||:...|....
plant   612 FLDSEDCMNLIR--QRKSL----GDDIALKSIHHLKSVVTHKVLLIDSKILLIDNSRITLLTNLT 670

  Fly   820 QQLQFQQIQQIQQIHQ-------IQQQIPASIEIYATL-----------PKRKSPLKALASASAC 866
            :...|.....|.::.:       :..:..|..:|.|..           .|:|:..:...|.|..
plant   671 RLSAFDNRTYILRLLKPFLLNEIVNMESNAKSDIAAAYLLLEEEKKSRSKKKKNNKRNSTSLSTP 735

  Fly   867 DDNAIEYEQEKQL---ATSPG---------KP------ERESRSLFGRKDKEKEKRSRSEDRNKL 913
            .|..:|:|....|   .|||.         :|      ||....:....|.::|......|...:
plant   736 LDKTVEHEPSVDLEPGVTSPSLKIVKEDFMEPEDTRAGERGRLEISSNTDNQEEATKFDPDMQNM 800

  Fly   914 TREFSLTE 921
            .||.||:|
plant   801 PREDSLSE 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072
AT5G51530NP_199966.1 DUF627 18..125 CDD:282615
DUF629 189..648 CDD:282614 22/106 (21%)
UCH 850..1142 CDD:278850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.