DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT3G47890

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_001319705.1 Gene:AT3G47890 / 823944 AraportID:AT3G47890 Length:1568 Species:Arabidopsis thaliana


Alignment Length:308 Identity:94/308 - (30%)
Similarity:140/308 - (45%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DRC-INAVIELFQQLQTSS-----EPALCPEPLRRALASGPLAGRRFPLGCLGDAAECFELL--- 191
            |.| :.::..:|..|.|:|     || :.|..||.||::.......|....:.||:|...::   
plant  1278 DPCVVCSLYAIFTALSTASSETRKEP-VAPSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIFDC 1341

  Fly   192 LHRVHSHISP-DDGDSCESS----------ACIAHRRFAMRVIEQSVC-KCGANSEQLPFTQMVH 244
            |||..:..|. .|.:|.||:          :||||..|.|.|.||..| .||..|..|.:|...|
plant  1342 LHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFGMDVSEQLNCYSCGLESRHLKYTSFFH 1406

  Fly   245 YVSASALTSQKSLALQSHQQLSFGQLL------------RAAGNMGDIRDCPNTCGAKIGICRAL 297
            .::||||.:.|....::    ||.:||            |.||.          ||.:..|...|
plant  1407 NINASALRTMKVTCAEN----SFDELLNLVEMNHQLACDREAGG----------CGKRNHIHHIL 1457

  Fly   298 LNRPEVVSIGIVWDSERPAADQVHAVLKAVGTSLRLGDVFHQVSEPRWAQQTQHELVGIVSYYGK 362
            ...|.|.:|.:.|.:.....:.:.|.|.|:.|.:.:..::..| :|:    ..:.||.:|.|||:
plant  1458 TTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGV-DPK----NTYSLVSVVCYYGQ 1517

  Fly   363 HYTTFFFHTKLKVWVYFDDANVKEVGPSWEGVVDKCSRGRYQPLLLLY 410
            ||..|.:..:...|:.:||.|||.:| ||..|:..|.||..||.:|||
plant  1518 HYHCFAYSHEHDQWIMYDDQNVKVIG-SWSDVLSMCKRGHLQPQVLLY 1564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072 78/253 (31%)
AT3G47890NP_001319705.1 DUF627 22..131 CDD:398447
DUF629 286..812 CDD:398446
UCH 1235..1564 CDD:395355 92/306 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2037
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002086
OrthoInspector 1 1.000 - - oto4080
orthoMCL 1 0.900 - - OOG6_104646
Panther 1 1.100 - - LDO PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.