DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT2G34230

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_180970.1 Gene:AT2G34230 / 817984 AraportID:AT2G34230 Length:716 Species:Arabidopsis thaliana


Alignment Length:279 Identity:54/279 - (19%)
Similarity:93/279 - (33%) Gaps:88/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 DCEKLCHEADQLLEKSRLVEESHDLETALVLCNAAAGRARAAMD--APYSNPHTMTFARMKHNTC 767
            :|...|...|.|::   ..||..||          .|.:.:.:|  :.:.||..:.|..:||...
plant   358 NCTLSCTLWDWLID---YTEEHLDL----------PGVSGSYLDKCSFFKNPQCICFLDLKHLKH 409

  Fly   768 VMRARS---------------------------------------LHRRILVEKGAETEAMPELK 793
            :::..|                                       |.:|:|.|:..|.:....::
plant   410 ILKKFSQLTTDVRESLVSKVVNQLWENSLVKERLDLEGHTNSNLLLDKRLLCEEELELDQNETVE 474

  Fly   794 HMREGSTSSVKHVRQNSKDRTLE------KEQQQLQFQQIQQIQQIHQIQQQIPASIEIYATLPK 852
            |..  ||...:.|.... |:.:.      |..::...|..:..:.:|..:..: |.:.|...|.:
plant   475 HYE--STGIYEDVMPKG-DKIVSWILDCPKIDKEFMSQMAKVAKGLHNREIWL-AVLRIVQGLVR 535

  Fly   853 RKSPLKALASASACDDNAIEYEQEKQLATSPGKPERESRSLFGRKDKEKEKRSRSEDRNKLTREF 917
            :|.        |..|........||.|.        |..::..|:|..|....||      |.||
plant   536 KKE--------SYYDKRRKMLSYEKMLC--------EVETICDREDTRKNVNQRS------TYEF 578

  Fly   918 SL-TE-TLLVNAKDTLKKH 934
            :| || ..||..:|..:|:
plant   579 ALRTECEKLVGKQDDNRKY 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072
AT2G34230NP_180970.1 DUF627 23..139 CDD:282615
DUF629 193..650 CDD:282614 54/279 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.