DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and MEE20

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_180969.2 Gene:MEE20 / 817983 AraportID:AT2G34220 Length:753 Species:Arabidopsis thaliana


Alignment Length:205 Identity:35/205 - (17%)
Similarity:74/205 - (36%) Gaps:56/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1186 PELDLEPLNQQ----------LSQLQALEAASKQ------QRQQLESLEGTTSILAQLQQRQHLL 1234
            ||:|.|.::|.          |:.|:.:....::      :|:::.:.|........:..|:...
plant   535 PEIDREFVSQMANGVHNSKLWLAALRIVRCVIRKKESYYDKRRKMLTYEKMLGEAETICDREDTR 599

  Fly  1235 KLRKEQANHPGAATTDATWLKELQAKQANDLRAMQRKLEASSPSSVRDLTHRFEQTSIRSYASQE 1299
            |...:::.:..|.....   ::|..||.:|.:...        |.|||:..|....|...:..::
plant   600 KNVNQRSTYESALRMKC---EDLVGKQDDDTKCFL--------SVVRDVFERQSSPSFEVFEDKK 653

  Fly  1300 LLSQPGQSQQLGQLRTQMNGLPNGNAKMDVDEVDAMPAVRNSLPAALSAHQLLPKPKYEMTQSQI 1364
            .:|:...:            :||.:.|      .::..:|.||           |.|:.:..|:|
plant   654 CISELSST------------VPNDDVK------KSLLTLRKSL-----------KEKFPLIDSKI 689

  Fly  1365 AEEIREVELL 1374
            .:.....|.|
plant   690 LQNKSTYEKL 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072
MEE20NP_180969.2 DUF627 56..172 CDD:282615
DUF629 228..682 CDD:282614 30/186 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.