DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ec and AT2G27650

DIOPT Version :9

Sequence 1:NP_001096877.1 Gene:ec / 31339 FlyBaseID:FBgn0000542 Length:1765 Species:Drosophila melanogaster
Sequence 2:NP_180333.2 Gene:AT2G27650 / 817311 AraportID:AT2G27650 Length:1106 Species:Arabidopsis thaliana


Alignment Length:426 Identity:83/426 - (19%)
Similarity:136/426 - (31%) Gaps:132/426 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PRSSPRKLILDGADKSATLTRQQSKQKSVSALAKVA--------------SSVELA-------VM 113
            |:.||    :....|..|..::.|...| |.|:|..              .|:||.       ||
plant   725 PKPSP----IQSKKKKNTSKKRNSTSMS-SPLSKPGEHLEPETTSPTVEEDSMELGDTVNQEEVM 784

  Fly   114 GYNSTGNGNSNGHINSA-------GNSERDRCINAVIEL----------FQQLQTSSE------- 154
             .|..|..:.:.|:.||       .||..|..:.|::.:          .|.||...|       
plant   785 -KNMLGEDSQSEHLESALSEASARYNSALDMTLKALLNIKILKEDLMHNMQPLQHHLEDQVPSVL 848

  Fly   155 ----PALCPEPLRRA-----LASGPLAGRRFPLGCLGDAAECFELLLHRVHSHISPDDGDSCESS 210
                .|...|.::..     |.|..||.....|.....|||....:|...|          |..:
plant   849 QNFFTAFVSEEIKTEGVYSYLLSDLLALLEEVLSMSSGAAEVLVAILEFWH----------CWKN 903

  Fly   211 A---CIAHRRFAMRVIEQSVCKCGANSEQLPFTQMVHYVSASALTSQKSLALQSHQQLSFGQLLR 272
            |   .:..|.|.:...|:..|:........|                        :|.|:| ::.
plant   904 AERESLVTRLFTLEEKERMSCRKCRKKPNYP------------------------EQSSYG-IVM 943

  Fly   273 AAGNMGDIR-----------------DCPNTCGAKIGIC-------RALLNRPEVVSIGIVWDSE 313
            ||.::.|::                 |....|..|.|.|       ..:...|.:.:|.:.|:..
plant   944 AADSIRDLKCALGNIEFVDILKVIRMDYTMLCDIKNGGCGIANFIHHIISKCPPIFTIVLEWEKS 1008

  Fly   314 RPAADQVHAVLKAVGTSLRLGDVFHQVSEPRWAQQTQHELVGIVSYYGKHYTTFFFHTKLKVWVY 378
            . ...::....||....:.:..::..: ||:    |.:.|..:|....|.......:.|.: ||.
plant  1009 E-TEKEISETTKAFEWEIDISRLYAGL-EPK----TNYRLASMVGCDEKQEHICIAYEKNR-WVN 1066

  Fly   379 F--DDANVKEVGPSWEGVVDKCSRGRYQPLLLLYAV 412
            .  |....::|| :|:.||..|...:.:|.:|.|.|
plant  1067 LRRDALAGEDVG-NWKSVVRFCGERKVRPEILFYEV 1101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecNP_001096877.1 Peptidase_C19 183..410 CDD:239072 46/255 (18%)
AT2G27650NP_180333.2 DUF627 18..125 CDD:282615
DUF629 195..655 CDD:282614
UCH 806..1099 CDD:278850 61/335 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1887
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22975
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.