DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and GDE1

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_015215.1 Gene:GDE1 / 855994 SGDID:S000006031 Length:1223 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:47/208 - (22%)
Similarity:79/208 - (37%) Gaps:53/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVE-----------------NAPSPLTSSDYEVQ 48
            ||||||:.:|...||..||:.|..||::||:...                 ..|:.:..|....|
Yeast     1 MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKNSYDEGRPPTKMRDSSNSAQ 65

  Fly    49 AY-----YKAFEETFLTECQSELTGVNNFF----------LEKLLEARRKHGHLKLQLLAYSREP 98
            .|     .:....:|......::..|:.|:          .|:||.: .:...:|..|:..:.:.
Yeast    66 NYLDSPKIQKLLASFFFAVDRDIEKVDTFYNSQYAEYKKRFERLLSS-NQFNEIKSTLVVDANKE 129

  Fly    99 GHTGSDSSLSQRAERSQKKLM--TTRQLRYAYAEFYLSLVLIQN--------------YQSLNET 147
            ....  .:|..:..|....|:  |::..|.:|.:.  .|:.||:              |..||:.
Yeast   130 DAVA--QTLLTKDTREMNMLLKGTSQASRLSYHKD--DLIEIQSILAELRKQFRNLKWYAELNKR 190

  Fly   148 GFRKICKKYDKNM 160
            .|.||.||.||.:
Yeast   191 AFGKILKKLDKKV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 47/208 (23%)
SPX_XPR1_like 2..158 CDD:269898 44/203 (22%)
EXS 260..597 CDD:281164
GDE1NP_015215.1 COG5408 1..300 CDD:227695 47/208 (23%)
ANKYR 361..594 CDD:223738
ANK repeat 427..466 CDD:293786
ANK repeat 468..501 CDD:293786
ANK repeat 506..535 CDD:293786
Ank_2 508..603 CDD:403870
ANK repeat 540..569 CDD:293786
ANK repeat 572..603 CDD:293786
GDPD_YPL110cp_fungi 871..1219 CDD:176548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.