DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and VTC4

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_012522.2 Gene:VTC4 / 853441 SGDID:S000003549 Length:721 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:47/226 - (20%)
Similarity:76/226 - (33%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            ||||:.....|..::...|:.|.|||..::..:.......|          :..|..||...:.|
Yeast     1 MKFGEHLSKSLIRQYSYYYISYDDLKTELEDNLSKNNGQWT----------QELETDFLESLEIE 55

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTT--------- 121
            |..|..|       .:.||                    |.:.:|.:..|:::..|         
Yeast    56 LDKVYTF-------CKVKH--------------------SEVFRRVKEVQEQVQHTVRLLDSNNP 93

  Fly   122 -RQLRYAYAEFYLSLVL-----IQNYQSLNETGFRKICKKYDKNMRSVAAGRWFVENVLDAPFTD 180
             .||.:...|..||.::     :..:..||.|||:||.||:||....:.           .|...
Yeast    94 PTQLDFEILEEELSDIIADVHDLAKFSRLNYTGFQKIIKKHDKKTGFIL-----------KPVFQ 147

  Fly   181 VRL---------LQRMTIEVEDLYTTHLANG 202
            |||         ...:.:::..||.....:|
Yeast   148 VRLDSKPFFKENYDELVVKISQLYDIARTSG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 40/175 (23%)
SPX_XPR1_like 2..158 CDD:269898 37/170 (22%)
EXS 260..597 CDD:281164
VTC4NP_012522.2 COG5036 1..497 CDD:227369 47/226 (21%)
DUF202 593..721 CDD:415817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.