DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and ERD1

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_010702.4 Gene:ERD1 / 852023 SGDID:S000002822 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:383 Identity:77/383 - (20%)
Similarity:137/383 - (35%) Gaps:122/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 IFEIDPRSHLQPATFLEIACTFGILWALSMLGFLYNDLIGVSDPYVFPLGLILIMVGLLVVP--- 354
            |..:.|     |..|:.:......:|...:..||:::| .||.       :||..|...:.|   
Yeast    16 ILNVPP-----PQRFIVLIILALWIWTWILKFFLHSNL-DVSQ-------VILTRVPHDIRPGYT 67

  Fly   355 LPIMNWPARWWTIKLVGRVITAPLHYVGFADFWMGDQMN----------------SLVSCIVDHY 403
            |..::..||.:.:|:...:|  |.|   ||..::.:.||                .|:.|:...:
Yeast    68 LQQLHRTARNFALKITRIII--PFH---FATVFLFEFMNIIEGPLKNIILIVYFLPLIQCVTIFW 127

  Fly   404 YTVRFYAISWLRY-----------------------DRVNNCFEPDVMVPITM------------ 433
            :.::...|  ::|                       |.:.:..:|  ::..|:            
Yeast   128 FLLKECQI--IKYCTRRCLLIESSPRSLRNTYILISDTLTSFAKP--LIDFTLFTSLIFREPFTH 188

  Fly   434 ------CLPGWFRFAQCLRRFRDSGSKSMSYLINAGKYSTTFLVVLFSTLRRNSEGGYAN--TFS 490
                  .||...|..||||.:|.....::  |.||.|||.. |.:||.|.|.....|..|  ...
Yeast   189 FDLSVALLPVLVRLLQCLREYRLLHEATL--LFNALKYSCN-LPILFCTWRSRVYEGSINEERLH 250

  Fly   491 NPYTWLFLSSCVVATIYCYLWDVIRDFGL-----FRIMRGERIFLRKQLVYPQAFYYFVIVENLV 550
            :...|..|    :.:.|...|||..|:.|     .|......:.|:|::      |:..|:.:.:
Yeast   251 HVQRWFML----INSSYTLFWDVRMDWSLDSLTSLRSRSKSAVTLKKKM------YHSAILVDFL 305

  Fly   551 LRLFWAVEFTILYHNLMTPYNMRTISS------------ILEITRRFIWNYVRLENEH 596
            ||.:|...:        ...|::.:::            ..|:.||.||...:|:.|:
Yeast   306 LRFWWLWVY--------LSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKLDAEY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695
SPX_XPR1_like 2..158 CDD:269898
EXS 260..597 CDD:281164 77/383 (20%)
ERD1NP_010702.4 EXS 1..362 CDD:413852 77/383 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.