DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and VTC2

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_116651.1 Gene:VTC2 / 850544 SGDID:S000001890 Length:828 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:39/163 - (23%)
Similarity:63/163 - (38%) Gaps:34/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQ-----GVENAPSPLTSSDYEVQAYYKAFEETFLT 60
            |.||....:.:...|:..|:.|..||:.:|:     |..:..:....||          |..|:.
Yeast     1 MLFGVKLANEVYPPWKGSYINYEGLKKFLKEDSVKDGSNDKKARWDDSD----------ESKFVE 55

  Fly    61 ECQSELTGVNNFFLEKLLEARRKHGHLKLQLLAYSREPGHTGSDSSLSQRAERSQKKLMTTRQLR 125
            |...||..|..|.|:|......:..||:.|          |.:::::         |.:.....:
Yeast    56 ELDKELEKVYGFQLKKYNNLMERLSHLEKQ----------TDTEAAI---------KALDADAFQ 101

  Fly   126 YAYAEFYLSLVLIQNYQSLNETGFRKICKKYDK 158
            ....|.......:.|::.||.|||.||.||:||
Yeast   102 RVLEELLSESTELDNFKRLNFTGFAKIVKKHDK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 39/163 (24%)
SPX_XPR1_like 2..158 CDD:269898 36/160 (23%)
EXS 260..597 CDD:281164
VTC2NP_116651.1 COG5036 1..555 CDD:227369 39/163 (24%)
VTC1 662..791 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.