Sequence 1: | NP_570077.1 | Gene: | CG2901 / 31338 | FlyBaseID: | FBgn0029679 | Length: | 649 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001330175.1 | Gene: | SPX4 / 831385 | AraportID: | AT5G15330 | Length: | 387 | Species: | Arabidopsis thaliana |
Alignment Length: | 229 | Identity: | 61/229 - (26%) |
---|---|---|---|
Similarity: | 94/229 - (41%) | Gaps: | 58/229 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKFGKTYESHL--TI-EWRQQYMRYGDLKELIKQ--------GVENA------------------ 36
Fly 37 -------PSPLTSSDYEVQAYYKAFEETFLTECQSELTGVNNFFLEKLLEARRKHGHLKLQLLAY 94
Fly 95 SREPGHTGSDSSLSQRAERSQKKLMTTRQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKN 159
Fly 160 MRSVAAGRW-FVENVLDAPFTDVRLLQRMTIEVE 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2901 | NP_570077.1 | COG5408 | 1..162 | CDD:227695 | 50/196 (26%) |
SPX_XPR1_like | 2..158 | CDD:269898 | 47/191 (25%) | ||
EXS | 260..597 | CDD:281164 | |||
SPX4 | NP_001330175.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |