DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and SPX4

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001330175.1 Gene:SPX4 / 831385 AraportID:AT5G15330 Length:387 Species:Arabidopsis thaliana


Alignment Length:229 Identity:61/229 - (26%)
Similarity:94/229 - (41%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHL--TI-EWRQQYMRYGDLKELIKQ--------GVENA------------------ 36
            |||||.:.:||  |: |||.:::.|..||:|:|.        |..|:                  
plant    70 MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTTNISSA 134

  Fly    37 -------PSPLTSSDYEVQAYYKAFEETFLTECQSELTGVNNFFLEKLLEARRKHGHLKLQLLAY 94
                   |....|.|         .:.:|:.....||...|:|:::|..:...:...||.::...
plant   135 ADDGGVVPGVRPSED---------LQGSFVRILNDELEKFNDFYVDKEEDFVIRLQELKERIEQV 190

  Fly    95 SREPGHTGSDSSLSQRAERSQKKLMTTRQLRYAYAEFYLSLVLIQNYQSLNETGFRKICKKYDKN 159
            ..:.|...|:|..|:.....::.|:|          .:..:||::||.|||..|..||.||||| 
plant   191 KEKNGEFASESEFSEEMMDIRRDLVT----------IHGEMVLLKNYSSLNFAGLVKILKKYDK- 244

  Fly   160 MRSVAAGRW-FVENVLDAPFTDVRLLQRMTIEVE 192
             |:....|. |.:.||..||.....|.|:..|.|
plant   245 -RTGGLLRLPFTQLVLHQPFFTTEPLTRLVRECE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 50/196 (26%)
SPX_XPR1_like 2..158 CDD:269898 47/191 (25%)
EXS 260..597 CDD:281164
SPX4NP_001330175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.