DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and SPAC1D4.05c

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_593018.1 Gene:SPAC1D4.05c / 2542527 PomBaseID:SPAC1D4.05c Length:387 Species:Schizosaccharomyces pombe


Alignment Length:381 Identity:87/381 - (22%)
Similarity:145/381 - (38%) Gaps:80/381 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TWV---------IFNFY--MAANVAGWQQAGVNHILIFEIDPR------------SHLQPATFLE 309
            ||:         |.|.|  ::.|..|...:...|:|...:..|            :.:.|..|..
pombe    28 TWLWSVCYHLIYILNRYQPISPNPRGSLNSKWYHLLQIPLSNRHTDLEENTEFKANLVSPVDFHA 92

  Fly   310 IACTFGIL---WALSMLGFL---YNDLIGVSDPYVFPLGLILIMVGLLVVPLPIMNWPARWWTIK 368
            ..|...||   ||...:.||   ..|:.|:....::||..::....|:|.|.|   |..|.....
pombe    93 GYCFAAILSISWATGFILFLKKTQGDIGGLYSHPIYPLLWVITAFILIVFPFP---WRYRSSQRG 154

  Fly   369 LVGRVITAPLHYVG-----FADFWMGDQMNSLVSCIVDHYYTVRFYAISWLRYDRVNN-CFEPDV 427
            |...:|...|.:..     :.||.:.:...|....:.|      ||....:....::. ...||:
pombe   155 LRKSIIRVFLFFQADFRSPYKDFIVSEIFTSYAKALGD------FYIFGCVLQGHISKFTLRPDL 213

  Fly   428 ------MVPITMCLPGWFRFAQCL-----RR---FRDSGSKSMSYLINAGKYSTTFLVVLFSTLR 478
                  .||:.|..|......|||     ||   |:.:       |::|.|::|...|:..|.:.
pombe   214 KCDGTFFVPLAMAYPFIVAILQCLHYGLSRRKHTFKIN-------LLSALKHATALPVIYLSAII 271

  Fly   479 RNSEGGYANTFSNPYT-WLFLSSCVVATIYCYLWDVIRD----FGLFRIMRGERIFLRKQLVYPQ 538
            ...:..:..|..:.|. ||::.|.::::.|.:||||..|    |...:.:..:|        :|.
pombe   272 HAKQTKFTLTSGHGYLFWLWILSALLSSAYTFLWDVFIDWRIRFPFHKSINHKR--------FPM 328

  Fly   539 AFYYFVIVENLVLRLFWAVEFTILYHNLMTPYNMRTIS-SILEITRRFIWNYVRLE 593
            ..|......|.:||:.|:::.....|. ...|.|...| .:|||.|||:|.:..|:
pombe   329 FIYAIGCFINFILRVTWSMKLHPRLHQ-FHEYEMGIFSFEMLEILRRFLWLFFHLD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695
SPX_XPR1_like 2..158 CDD:269898
EXS 260..597 CDD:281164 87/381 (23%)
SPAC1D4.05cNP_593018.1 COG5409 2..387 CDD:227696 87/381 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X439
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.