DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2901 and SPAC14C4.11

DIOPT Version :9

Sequence 1:NP_570077.1 Gene:CG2901 / 31338 FlyBaseID:FBgn0029679 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_594916.1 Gene:SPAC14C4.11 / 2541428 PomBaseID:SPAC14C4.11 Length:734 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:63/224 - (28%)
Similarity:94/224 - (41%) Gaps:41/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTYESHLTIEWRQQYMRYGDLKELIKQGVENAPSPLTSSDYEVQAYYKAFEETFLTECQSE 65
            |:|..:.|:.:...||.:||.|.:||.|:|. .|.|||           :.:..|..|::...::
pombe     1 MRFSDSIEAGIYEPWRDKYMNYPELKHLLKT-EEEAPS-----------WGENDESKFVSVMDAQ 53

  Fly    66 LTGVNNFFLEKLLEARRKHGHLKLQLLAYSREP-GHTGSDSSLSQRAERSQKKLMTTRQLRYAYA 129
            |..|..|.||.|.|.......:|.::.| |:|| |...|.....:..||......|.::|     
pombe    54 LEKVYAFHLEILKELNESVDWVKSKVSA-SQEPDGPPISKEEAIKLLERLDSCTETVKKL----- 112

  Fly   130 EFYLSLVLIQNYQSLNETGFRKICKKYDK-----NMRSVAAGRWFVENVLDAPFTDVRLLQRMTI 189
                     :.|..||.|||.||.||:||     ::|.|     |...:...|...|: ...:..
pombe   113 ---------EKYTRLNLTGFFKIVKKHDKLYPGYSLRPV-----FQVRLRACPLGSVQ-FNPLLA 162

  Fly   190 EVEDLYTTHLANGDRSLAMEKLRVPPLGE 218
            |:..||.| |.:| .|.....::|.|..|
pombe   163 EIFSLYNT-LRDG-LSAPSNSVQVKPKHE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2901NP_570077.1 COG5408 1..162 CDD:227695 48/166 (29%)
SPX_XPR1_like 2..158 CDD:269898 45/156 (29%)
EXS 260..597 CDD:281164
SPAC14C4.11NP_594916.1 COG5036 1..497 CDD:227369 63/224 (28%)
SPX_VTC2_like 2..132 CDD:269901 45/156 (29%)
PolyPPase_VTC2-3_like 195..490 CDD:143630
VTC1 592..718 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.