DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and FOXH1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_003914.1 Gene:FOXH1 / 8928 HGNCID:3814 Length:365 Species:Homo sapiens


Alignment Length:96 Identity:31/96 - (32%)
Similarity:51/96 - (53%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 DTSSKAPK----------KPPFTYTELIEYALE--DKGELTVSGIYQWISDRFPYYKSNDDRWKN 445
            ::.|:.||          |||:||..:|...::  ....|.::.|.:.:...||:::.:.:.||:
Human    15 ESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKD 79

  Fly   446 SVRHNLSINPHFRKGVK---APQGAGHLWAI 473
            |:|||||.|..|||..|   .||..|:.||:
Human    80 SIRHNLSSNRCFRKVPKDPAKPQAKGNFWAV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 27/76 (36%)
FOXH1NP_003914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 3/13 (23%)
FH_FOXH 33..111 CDD:410796 28/78 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..215
SMAD-interaction domain (SID) 273..354
Fast/FoxH1 motif 1 (FM1) 277..281
Fast/FoxH1 motif 2 (FM2) 287..293
SMAD interaction motif (SIM) 327..348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.