DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and foxh1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_571577.1 Gene:foxh1 / 57930 ZFINID:ZDB-GENE-000616-15 Length:472 Species:Danio rerio


Alignment Length:272 Identity:67/272 - (24%)
Similarity:105/272 - (38%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 SPKSCSSAAMP-AALGGGGNGSAGASAAGGVAGVGSTKTGRKFEELVMEVTSEL-DGNDMIVAEH 388
            |.:||..::.| ..|||..:.|.| .|........:|..|          ..|| |||       
Zfish    37 SKRSCHRSSNPLLELGGRLDKSTG-MAQDSCYRAKATNQG----------PWELQDGN------- 83

  Fly   389 VVVEDTSSKAPK-------KPPFTYTELIEYALEDKGE--LTVSGIYQWISDRFPYYKSNDDRWK 444
                  ||...|       |||::|..:|...:::..|  ||:|.|.:.||..||::|.|...|:
Zfish    84 ------SSGGKKKNYQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYKGWR 142

  Fly   445 NSVRHNLSINPHFRKGVK---APQGAGHLWAISSGDSAENVLAWEHKKQRLDLFFKMESINRERI 506
            :|||||||....|.|.:|   .|||.|:.|.:              :..|:.|    |.:.|:..
Zfish   143 DSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTV--------------EVNRIPL----ELLKRQNT 189

  Fly   507 QQHQQQQQL----------QQHQQQHQQHS-PQQKQHSAAQQQHMPQASSCMYD---EAAVAVAT 557
            ...:|.:.:          |.:.|.::... |.:........:..|..|...|.   ::..|:.:
Zfish   190 AVSRQDETIFAQDLAPYIFQGYSQPNKSKPLPPESSLPPVPTRQSPPPSEDPYRPKLDSTFAIDS 254

  Fly   558 LTQEMMQTNSGG 569
            |...:...:|.|
Zfish   255 LLHSLRPASSAG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 32/76 (42%)
foxh1NP_571577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 7/18 (39%)
FH_FOXH 97..175 CDD:410796 32/91 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..246 5/34 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..360 2/6 (33%)
SMAD-interaction domain (SID) 339..465
Fast/FoxH1 motif 1 (FM1) 357..361
Fast/FoxH1 motif 2 (FM2) 367..373
SMAD interaction motif (SIM) 428..448
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.