DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and FOXB2

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001013757.1 Gene:FOXB2 / 442425 HGNCID:23315 Length:432 Species:Homo sapiens


Alignment Length:218 Identity:57/218 - (26%)
Similarity:81/218 - (37%) Gaps:75/218 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 SSKAPKKPPFTYTELIEYALEDKGE--LTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHF 457
            ||.:.:|||::|..|...|::...|  |.:|.||::|.:|||||:.:..||:||:|||||.|..|
Human     7 SSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCF 71

  Fly   458 RKGVKAPQ--GAGHLWAI--SSGDSAENVLAWEHKKQRLDLFFKMESINRERIQQHQQQQQLQQ- 517
            .|..:.|.  |.|..||:  ..||..||......:|:     ||:  :..:....|....:... 
Human    72 IKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKR-----FKV--LRADHTHLHAGSTKSAPG 129

  Fly   518 -----HQQQHQQHSPQQKQHSAAQQQHMPQASSCMYDEAAVAVATLTQEMMQTNSGGGSTETSQQ 577
                 |...|..|.|                                                  
Human   130 AGPGGHLHPHHHHHP-------------------------------------------------- 144

  Fly   578 QQQQQQHHHHHSHQNHQNHNQHH 600
                  |||||.|....:|:.||
Human   145 ------HHHHHHHAAAHHHHHHH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 33/75 (44%)
FOXB2NP_001013757.1 FH_FOXB2 1..110 CDD:410817 41/107 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..220 14/100 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..432
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.