DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and foxg1b

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:111 Identity:44/111 - (39%)
Similarity:62/111 - (55%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 SELDGNDMIVAEHVVVEDTSSKAPKKPPFTYTELIEYALEDKGE--LTVSGIYQWISDRFPYYKS 438
            :|:| |....||...::....|...||||:|..||..|:....|  ||::|||::|...||||:.
Zfish    53 AEMD-NAQRDAEEPELQTKKGKKFDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRE 116

  Fly   439 NDDRWKNSVRHNLSINPHFRKGVKAPQ-----GAGHLWAI--SSGD 477
            :...|:||:|||||:|..|   ||.|:     |.|:.|.:  ||.|
Zfish   117 HKQGWQNSIRHNLSLNKCF---VKVPRHYDDPGKGNYWMLDPSSDD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 35/78 (45%)
foxg1bNP_998079.2 FH_FOXG 77..155 CDD:410795 35/80 (44%)

Return to query results.
Submit another query.