DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and foxi1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:304 Identity:71/304 - (23%)
Similarity:114/304 - (37%) Gaps:79/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GSAPP----------HPPSTAVPIATSPCSSSSPSSASAASASASAISTNQSLGSGLVDQRARSP 327
            |..||          ||       .|.| |...||:...|..|.:| :....|....:......|
 Frog    22 GQEPPEMNIYCDSIFHP-------QTMP-SPQRPSNFETADYSTTA-NPYLWLNGPSITPPPYLP 77

  Fly   328 KSCSSAAMPAALGGGGNGSAGASAAGGVAGVGSTKTG----RKFEELVMEVTSELDGNDMIVAEH 388
            .|.:|..||.:.|      ........:.|:|.:..|    ...|||:..|              
 Frog    78 GSNTSHFMPQSYG------MQRQLLPNMHGLGGSDLGWLPIPSQEELMKLV-------------- 122

  Fly   389 VVVEDTSSKAPKKPPFTYTELIEYALE---DKGELTVSGIYQWISDRFPYYKSNDDRWKNSVRHN 450
                        :||::|:.||..|:.   || .||:|.|||:::|.||:|..:...|:||:|||
 Frog   123 ------------RPPYSYSALIAMAIHGAPDK-RLTLSQIYQYVADNFPFYNKSKAGWQNSIRHN 174

  Fly   451 LSINPHFRKGVKAPQ-----GAGHLWAISSG--DSAENVLAWEHKKQRLDLFFKMESINRERIQQ 508
            ||:|..|:   |.|:     |.|:.|.:...  ...:|......:|::.|:     |.|.:....
 Frog   175 LSLNDCFK---KVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDV-----SPNGQISSD 231

  Fly   509 HQQQQQLQQHQQQHQQH-----SPQQKQHSAAQQQHMPQASSCM 547
            ..:...|.:..:..:.|     |......|:.::...|..:.|:
 Frog   232 KPEGSPLNESPKNGEHHDMLGNSSPGTDDSSEKRSPPPSITPCL 275

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 33/79 (42%)