DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and Foxi2

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:214 Identity:59/214 - (27%)
Similarity:95/214 - (44%) Gaps:59/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 NLPEG--SAPPHPPSTAVPIATSPCSSSSPSSASAASASASAISTNQSLGSGLVDQRARSPKSCS 331
            ::|.|  .|..||||    ...:..||......::|:.|.:..:|    |.|.....|     .:
Mouse    12 SVPHGLTRAIAHPPS----YGRTDLSSGRRLWVNSAALSPAPYAT----GPGPAPSYA-----AA 63

  Fly   332 SAAMPAALGGGGNGSAGASAAGGVAGVGSTKTGRKFEELVMEVTSELDGNDMIVAEHVVVEDTSS 396
            :.|:|.:|.|...|.|||..|      ..:.:|:  :||:..|                      
Mouse    64 TLAVPGSLLGASGGLAGADLA------WLSLSGQ--QELLRLV---------------------- 98

  Fly   397 KAPKKPPFTYTELIEYALEDK--GELTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHFRK 459
                :||::|:.||..|::..  ..||:|.|||:::..||:||.:...|:||:|||||:|..|: 
Mouse    99 ----RPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFK- 158

  Fly   460 GVKAPQ-----GAGHLWAI 473
              |.|:     |.|:.|.:
Mouse   159 --KVPRDENDPGKGNYWTL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 31/78 (40%)
Foxi2NP_899016.2 FH_FOX 96..188 CDD:469596 32/109 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.