DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and Foxl1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:222 Identity:60/222 - (27%)
Similarity:92/222 - (41%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 PKKPPFTYTELIEYALEDKGE--LTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHFRKGV 461
            |:|||::|..||..|::|..|  :|::||||:|.||||:|..|...|:||:|||||:|..|   |
Mouse    47 PQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECF---V 108

  Fly   462 KAPQ-----GAGHLWAISSGDSAENVLAWEHKKQRLDLFFKMESINRERIQQHQQQQQLQQHQQQ 521
            |.|:     |.|..|.:.              .:.||:|   |:.|..|          ::.:.:
Mouse   109 KVPREKGRPGKGSYWTLD--------------PRCLDMF---ENGNYRR----------RKRKPK 146

  Fly   522 HQQHSPQQKQHSAAQQQHMPQASSCMYD----EAAVAVATLTQEMMQTNSGG------------- 569
            ....||:.|:....     |..|....|    :.|.|:.|...:..|:.:.|             
Mouse   147 PAAGSPEAKRTRVE-----PPESEVGCDVGSPDLATALPTRAPDRSQSPAVGTARPALLPWPGPE 206

  Fly   570 -----------GSTETSQQQQQQQQHH 585
                       |:...:..|.|:..||
Mouse   207 PRDPDADLTVQGAGAVASGQLQRPAHH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 37/78 (47%)
Foxl1NP_032050.2 FH_FOXL1 47..144 CDD:410801 44/126 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 12/88 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 3/7 (43%)

Return to query results.
Submit another query.