DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and Foxs1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:85 Identity:36/85 - (42%)
Similarity:51/85 - (60%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SKAPKKPPFTYTELIEYALEDK-GE-LTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHFR 458
            |..|.|||::|..||..|::.. |: .|:||||::|..||.:|:.|...|:||:|||||:|..| 
Mouse    13 SAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECF- 76

  Fly   459 KGVKAPQ-----GAGHLWAI 473
              ||.|:     |.|..|.:
Mouse    77 --VKVPRDDRKPGKGSYWTL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 34/78 (44%)
Foxs1NP_034356.1 FH_FOXS1 17..116 CDD:410811 34/81 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.