DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and Foxd4

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:151 Identity:54/151 - (35%)
Similarity:71/151 - (47%) Gaps:32/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GGNGSAGASAAGGVAGVGSTKTG--RKFEELVMEVTSELDGNDMIVAEHVVVEDTSSKAPKKPPF 404
            |....||.||  |..|..|..:|  |||.......|:..||                ..|.|||:
Mouse    60 GARTLAGRSA--GDCGDLSNSSGFLRKFRAPRTPATTTADG----------------PQPAKPPY 106

  Fly   405 TYTELIEYAL--EDKGELTVSGIYQWISDRFPYYKSNDDRWKNSVRHNLSINPHFRKGVKAPQ-- 465
            :|..||..|:  .....||:|||..:||.|||||:.....|:||:|||||:|..|   ||.|:  
Mouse   107 SYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCF---VKIPREP 168

  Fly   466 ---GAGHLWAI--SSGDSAEN 481
               |.|:.|::  :|.|..:|
Mouse   169 GHPGKGNYWSLDPASQDMFDN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 35/78 (45%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 5/11 (45%)
FH_FOXD4-like 103..198 CDD:410822 38/90 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.