DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd3F and Foxh1

DIOPT Version :10

Sequence 1:NP_001356931.1 Gene:fd3F / 31336 FlyBaseID:FBgn0264954 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_032015.1 Gene:Foxh1 / 14106 MGIID:1347465 Length:401 Species:Mus musculus


Alignment Length:96 Identity:31/96 - (32%)
Similarity:50/96 - (52%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 DTSSKAPK----------KPPFTYTELIEYALEDK--GELTVSGIYQWISDRFPYYKSNDDRWKN 445
            ::.||.||          |||:||..:|...::..  ..|.::.|.:.:...||:::.:.:.||:
Mouse    46 ESLSKTPKRRKKRYLRHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKD 110

  Fly   446 SVRHNLSINPHFRKGVK---APQGAGHLWAI 473
            |:|||||.|..|.|..|   .||..|:.||:
Mouse   111 SIRHNLSSNRCFHKVPKDPAKPQAKGNFWAV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd3FNP_001356931.1 Forkhead 401..473 CDD:459732 26/76 (34%)
Foxh1NP_032015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..57 4/10 (40%)
FH_FOXH 64..142 CDD:410796 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251
SMAD-interaction domain (SID) 307..390
Fast/FoxH1 motif 1 (FM1) 311..315
Fast/FoxH1 motif 2 (FM2) 321..327
SMAD interaction motif (SIM) 363..384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.