DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIP-R and Dpit47

DIOPT Version :9

Sequence 1:NP_001014719.2 Gene:HIP-R / 31335 FlyBaseID:FBgn0029676 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:90/222 - (40%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PEDSEDE---------KSLSDPESDVELDMEGVIEADSDPAQPMGNYSKKATEEEVEQASELRAQ 132
            |||...|         |....|..||....||:.:...||        ::.|.:|:  |...:..
  Fly    43 PEDRWQEEMDKHPFFMKRAPQPGDDVHPMFEGLQKLKYDP--------EENTRDEL--ALNYKED 97

  Fly   133 AASAYGQQKFDEAIALYTKAIELSPGN----ALFHAKRGQAFLKLKKPNACIRDCDVALELNSDL 193
            .......:||..||..:|:.|:....|    |:.:..|..|...:|...:.:.|...||....|.
  Fly    98 GNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDY 162

  Fly   194 AAGYKFRGRARRLLGDFELAAHDL-RQACK--LDFDEETDEWLKEVTPN-AKKIE-QHRLKQERR 253
            .   |.|.|:.:..  :||...|| .|.|:  |:.|.:.:..:..:..| .||:| :...::|..
  Fly   163 T---KARWRSAQCA--YELERFDLCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIERNQRKEAA 222

  Fly   254 QAERKIK--ERQRD---QRRARKEQEK 275
            :|:|::.  .|.||   ||..:.:.:|
  Fly   223 EAKRRLTRFHRLRDAIEQRAIKFDDQK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIP-RNP_001014719.2 Hip_N 10..47 CDD:271228
TPR_11 125..190 CDD:290150 15/68 (22%)
TPR_2 126..159 CDD:285020 7/32 (22%)
TPR repeat 126..154 CDD:276809 6/27 (22%)
TPR repeat 159..189 CDD:276809 8/33 (24%)
TPR repeat 194..222 CDD:276809 8/28 (29%)
STI1 299..336 CDD:128966
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 23/101 (23%)
TPR repeat 91..119 CDD:276809 6/27 (22%)
TPR repeat 124..158 CDD:276809 8/33 (24%)
TPR repeat 163..191 CDD:276809 9/32 (28%)
TPR repeat 197..227 CDD:276809 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.