DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIP-R and Tom70

DIOPT Version :9

Sequence 1:NP_001014719.2 Gene:HIP-R / 31335 FlyBaseID:FBgn0029676 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster


Alignment Length:280 Identity:61/280 - (21%)
Similarity:100/280 - (35%) Gaps:75/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFTMQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGV 65
            ||.|:..|.:|..|:.:...|..|..:.:                                  |.
  Fly     1 MAMTLNIGSMKLTKWQLALILGTPLAIGL----------------------------------GT 31

  Fly    66 AGAKANEPANAPEDSEDEKSLSDPESDVE---LDMEGVIEADSDPAQPMGNYSKKATEEE----V 123
            ...|:...|:...|.|.::    |::.:|   :.::|     :.|.|.:....|.|...|    :
  Fly    32 YAVKSWTAASKELDGEKKR----PKAKIEKQAISLDG-----TAPDQELERNQKSAELGEKLSPL 87

  Fly   124 EQASELRAQAASAYGQQKFDEAIALYTKAIELSPGN-----ALFHAKRGQAFLKLKKPNACIRDC 183
            ::|:..:.:..:.|...|:||||..|.|||:..|..     |:|:..|..::..|||.:....||
  Fly    88 KEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKEDC 152

  Fly   184 DVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEE------TDEWLKEVTPNAKK 242
            ..:||.|...|..|..|.||.....|......|:...|.|:..:.      .|..|||.      
  Fly   153 TASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQTIMFADRVLKET------ 211

  Fly   243 IEQHRLKQERRQAERKIKER 262
                    .|..||:.::.|
  Fly   212 --------GRLDAEKGMRNR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIP-RNP_001014719.2 Hip_N 10..47 CDD:271228 4/36 (11%)
TPR_11 125..190 CDD:290150 22/69 (32%)
TPR_2 126..159 CDD:285020 12/32 (38%)
TPR repeat 126..154 CDD:276809 10/27 (37%)
TPR repeat 159..189 CDD:276809 9/34 (26%)
TPR repeat 194..222 CDD:276809 7/27 (26%)
STI1 299..336 CDD:128966
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 22/70 (31%)
TPR repeat 90..118 CDD:276809 10/27 (37%)
TPR repeat 123..158 CDD:276809 9/34 (26%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.