DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rala

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038952037.1 Gene:Rala / 81757 RGDID:619851 Length:219 Species:Rattus norvegicus


Alignment Length:194 Identity:155/194 - (79%)
Similarity:169/194 - (87%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 74
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    26 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 90

  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSEC 139
            |||||||||||||||||||:.|||.||.:|||||||||.||::||||||||.||.|||:|.:.|.
  Rat    91 IRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEA 155

  Fly   140 QLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDR--CKKRRLKCTLL 201
            :.||.||.|.|||||||||.||||||||||||||:||.||||..:|:.|.:  .|:.|.:|.:|
  Rat   156 KNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 140/161 (87%)
RalaXP_038952037.1 RalA_RalB 28..190 CDD:206710 140/161 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1647
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3942
Inparanoid 1 1.050 304 1.000 Inparanoid score I2573
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm45153
orthoMCL 1 0.900 - - OOG6_104721
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.