DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and RALB

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001356329.1 Gene:RALB / 5899 HGNCID:9840 Length:206 Species:Homo sapiens


Alignment Length:194 Identity:146/194 - (75%)
Similarity:166/194 - (85%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 74
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human    13 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 77

  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDE-SIPFLLVGNKCDLNDKRKVPLSE 138
            |||||||||||||.|||||:.|||.||.||||||||||.:| .||.|:||||.||.::|:||:.|
Human    78 IRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEE 142

  Fly   139 CQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKR-RLKCTLL 201
            .:.:|::|.|.|||||||||.||||||||||||||::|..::|..:|:...:.||. :.:|.||
Human   143 ARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 135/162 (83%)
RALBNP_001356329.1 RalA_RalB 15..178 CDD:206710 135/162 (83%)
Effector region 43..51 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..206 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 279 1.000 Domainoid score I1704
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm41018
orthoMCL 1 0.900 - - OOG6_104721
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.