DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rgk3

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster


Alignment Length:190 Identity:54/190 - (28%)
Similarity:88/190 - (46%) Gaps:17/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKV--VLDGEEVQIDILDTAGQEDYAA 74
            ::|.|:||.||||.||..||...:.:..|:..:.|...:.|  :|:|.|.::..| |...|.   
  Fly   235 YRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFL-TGNPES--- 295

  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESI----PFLLVGNKCDLNDKRKVP 135
             :|. ....:.||.|:|..|.|||...    :|||....|..:    |.:||.||.||...|.|.
  Fly   296 -KDE-LEQADAFLVVYSCIDKESFTRA----KQILSRLQDMDLLRHRPTILVANKIDLARSRAVS 354

  Fly   136 LSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTE-DSKATSGRAKDRCKKR 194
            ..:.:..|..:...::|.|.....|.|::....:.:||.:|.: ..:....::||:.|.:
  Fly   355 AQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 49/167 (29%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 50/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.