DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and rras2

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001017815.1 Gene:rras2 / 550513 ZFINID:ZDB-GENE-050417-352 Length:202 Species:Danio rerio


Alignment Length:182 Identity:89/182 - (48%)
Similarity:126/182 - (69%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76
            :::::||.|||||||||:||:...||.||:||..|||.|:.|:|....::|||||||||::.|:|
Zfish    13 YRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPARLDILDTAGQEEFGAMR 77

  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141
            :.|.|:|||||.|||:||..||:...:|:.||||||:.:..|.:|||||.||..:|:|...|.|.
Zfish    78 EQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEQQRQVTQEEGQQ 142

  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED---SKATSGRAKDR 190
            .|:|..|.|:|.|||.|.|||:.|.:|:|.||..:.::   |...:.:.||:
Zfish   143 LARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 85/161 (53%)
rras2NP_001017815.1 M_R_Ras_like 11..174 CDD:133345 84/160 (53%)
RAS 25..176 CDD:214541 80/150 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.