DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and rala

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001015915.1 Gene:rala / 548669 XenbaseID:XB-GENE-485016 Length:206 Species:Xenopus tropicalis


Alignment Length:194 Identity:154/194 - (79%)
Similarity:168/194 - (86%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 74
            |||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||
 Frog    13 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGVEVQIDILDTAGQEDYAA 77

  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSEC 139
            |||||||||||||||||||:.|||.||.:|||||||||.||::||||||||.||.|||:|.:.|.
 Frog    78 IRDNYFRSGEGFLCVFSITEQESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEA 142

  Fly   140 QLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDR--CKKRRLKCTLL 201
            :.||.||.|.|||||||||.||||||||||||||:||.||||..:|:.|.:  .|:.|.:|.:|
 Frog   143 KSRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 139/161 (86%)
ralaNP_001015915.1 RalA_RalB 15..177 CDD:206710 139/161 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1699
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3942
Inparanoid 1 1.050 302 1.000 Inparanoid score I2626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm48220
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3397
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.