DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rit1

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038958818.1 Gene:Rit1 / 499652 RGDID:1559874 Length:219 Species:Rattus norvegicus


Alignment Length:194 Identity:85/194 - (43%)
Similarity:125/194 - (64%) Gaps:1/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQ 69
            |.|....:|::|:|:|||||||:|:||:...|.||::||..|:|:.::.:|.|...:||||||||
  Rat    15 PAALSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQ 79

  Fly    70 EDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKV 134
            .::.|:||.|.|:||||:..:||||..||...:||::.|.||:..:..|.:|||||.||...|:|
  Rat    80 AEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQV 144

  Fly   135 PLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKK-RRLK 197
            ...|....|:::..|:.||||..|..:|.||..|:||||.::.|...|...:||.:... :|||
  Rat   145 SKEEGLSLAREFNCPFFETSAAYRYYIDDVFHALVREIRKKEKELVLAMEKKAKPKSSVWKRLK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 75/161 (47%)
Rit1XP_038958818.1 Rit_Rin_Ric 20..191 CDD:206712 77/170 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.