DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and ralab

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001007322.1 Gene:ralab / 492355 ZFINID:ZDB-GENE-041114-195 Length:202 Species:Danio rerio


Alignment Length:194 Identity:152/194 - (78%)
Similarity:168/194 - (86%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 74
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     9 ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAA 73

  Fly    75 IRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSEC 139
            |||||||||||||||||||:.|||.||.:|||||||||.:|::||||||||.||.|:|:|.|.|.
Zfish    74 IRDNYFRSGEGFLCVFSITESESFAATADFREQILRVKEEENVPFLLVGNKSDLEDRRQVGLEEA 138

  Fly   140 QLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRL--KCTLL 201
            :.||:||.|.|||||||||.||||||||||||||:||.||.|..:|:.|.:....|:  :|.:|
Zfish   139 KARAEQWGVSYVETSAKTRANVDKVFFDLMREIRARKMEDGKEKNGKKKRKSLATRIRERCCIL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 139/161 (86%)
ralabNP_001007322.1 small_GTPase 11..174 CDD:197466 140/162 (86%)
RalA_RalB 11..173 CDD:206710 139/161 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 280 1.000 Domainoid score I1643
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 302 1.000 Inparanoid score I2652
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm24737
orthoMCL 1 0.900 - - OOG6_104721
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3397
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.