DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and ralba

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001003649.1 Gene:ralba / 445255 ZFINID:ZDB-GENE-040801-267 Length:207 Species:Danio rerio


Alignment Length:201 Identity:149/201 - (74%)
Similarity:169/201 - (84%) Gaps:3/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAG 68
            |..:..|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     7 KAQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAG 71

  Fly    69 QEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDE-SIPFLLVGNKCDLNDKR 132
            |||||||||||||||||||.|||||:.|||.||.||||||||||.:| .||.||||||.||.|:|
Zfish    72 QEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLLVGNKSDLEDRR 136

  Fly   133 KVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLK 197
            :|.:.|.:.:|::|||.|||||||||.||||||||||||:|::|..::|..:|:.|::..|:..|
Zfish   137 QVSVDEARGKAEEWAVQYVETSAKTRANVDKVFFDLMREVRAKKMSENKDKNGKGKNKKNKKSFK 201

  Fly   198 --CTLL 201
              |.||
Zfish   202 ERCCLL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 136/162 (84%)
ralbaNP_001003649.1 RalA_RalB 15..178 CDD:206710 136/162 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 280 1.000 Domainoid score I1643
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 302 1.000 Inparanoid score I2652
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm24737
orthoMCL 1 0.900 - - OOG6_104721
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.