DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and ralbb

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001002123.1 Gene:ralbb / 415213 ZFINID:ZDB-GENE-040625-121 Length:206 Species:Danio rerio


Alignment Length:203 Identity:145/203 - (71%)
Similarity:164/203 - (80%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAG 68
            |..:...||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     7 KAQSSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAG 71

  Fly    69 QEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDE-SIPFLLVGNKCDLNDKR 132
            |||||||||||||||||||.|||||:.|||.|:.||||||||||.:| .||.|:||||.||.::|
Zfish    72 QEDYAAIRDNYFRSGEGFLLVFSITEPESFSASAEFREQILRVKAEEDKIPLLVVGNKSDLEERR 136

  Fly   133 KVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATS----GRAKDRCKK 193
            :|...|.:.:|.:|.|.|||||||||.||||||||||||:|::|..::|..:    |:.|...|:
Zfish   137 QVSADEARSKADEWGVQYVETSAKTRANVDKVFFDLMREVRTKKMSENKEKNLKKGGKKKKSLKE 201

  Fly   194 RRLKCTLL 201
            |   ||||
Zfish   202 R---CTLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 132/162 (81%)
ralbbNP_001002123.1 RalA_RalB 15..178 CDD:206710 132/162 (81%)
RAS 15..177 CDD:214541 132/161 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.