DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and CG8500

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:213 Identity:65/213 - (30%)
Similarity:111/213 - (52%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76
            ::|::.|:||||||:|.|:|:...|.|.|.||..|:||:.:..:.....:.|.||.|...:.|::
  Fly    19 YRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAMQ 83

  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDE--SIPFLLVGNKCD-LNDKRKVPLSE 138
            ......|..|:.|:|:...:|.:..:.....|..:|..:  :||.:||||||| ..:.|:|..:|
  Fly    84 RLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREVSQAE 148

  Fly   139 CQLRAQQWAVPYVETSAKTRENVDKVFFDLM---------------REIRSRKTEDSKAT----- 183
            .|.:|..|::.::||||||..||.::|.:|:               ::.:.:|.:.||.|     
  Fly   149 GQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSKDTNGSIP 213

  Fly   184 ---------SGRAKDRCK 192
                     ||.||::|:
  Fly   214 ENGDAGASASGGAKEKCR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 56/179 (31%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 56/163 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.