DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rras2

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001013452.1 Gene:Rras2 / 365355 RGDID:1310793 Length:204 Species:Rattus norvegicus


Alignment Length:188 Identity:90/188 - (47%)
Similarity:126/188 - (67%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQED 71
            :|...:::::||.|||||||||:||:...||.||:||..|||.|:.|:|....::|||||||||:
  Rat    10 SGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEE 74

  Fly    72 YAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136
            :.|:|:.|.|:|||||.|||:||..||:...:|:.||||||:.:..|.:|:|||.||:.:|:|..
  Rat    75 FGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQ 139

  Fly   137 SECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIR-------------SRKTEDSK 181
            .|.|..|:|..|.|:|.|||.|.|||:.|.:|:|.||             :||.:|.|
  Rat   140 EEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 85/174 (49%)
Rras2NP_001013452.1 M_R_Ras_like 13..176 CDD:133345 83/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.