DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001101951.1 Gene:Rras / 361568 RGDID:1311443 Length:218 Species:Rattus norvegicus


Alignment Length:203 Identity:92/203 - (45%)
Similarity:125/203 - (61%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA 67
            :.|..|.. ||:::||.|||||||||:||:...||.||:||..|||.|...:||...::||||||
  Rat    22 RDPPPGET-HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTA 85

  Fly    68 GQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKR 132
            |||::.|:|:.|.|:|.|||.||:|.|.:||....:...||||||:.:..|.:|||||.||..:|
  Rat    86 GQEEFGAMREQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILRVKDRDDFPIVLVGNKADLETQR 150

  Fly   133 KVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED---SKATSGRAKD-RCKK 193
            :|..||....:....:.|.|.|||.|.|||:.|..|:|.:|..:.::   |..::.|.|| ||  
  Rat   151 QVLRSEASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRC-- 213

  Fly   194 RRLKCTLL 201
               .|.||
  Rat   214 ---PCVLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 80/161 (50%)
RrasNP_001101951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 2/8 (25%)
P-loop_NTPase 28..191 CDD:304359 80/163 (49%)
small_GTPase 42..193 CDD:197466 73/150 (49%)
Effector region 58..66 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.