DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and CG42541

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_996345.3 Gene:CG42541 / 31344 FlyBaseID:FBgn0260658 Length:1418 Species:Drosophila melanogaster


Alignment Length:173 Identity:52/173 - (30%)
Similarity:94/173 - (54%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKK---VVLDGEEVQIDILD-TAGQ 69
            || :|:.|:|:.||||:.||.||...:::..|:.:..|.|.:|   |::|..|..::|:| .|.:
  Fly  1006 PA-YKIAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYGQKTVSVLVDNIETDLEIIDHPACE 1069

  Fly    70 EDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILR-VKNDE---SIPFLLVGNKCDLND 130
            ....|....|  :.:.|:.|:|:.|..:|.|.    |::|: :|.:|   |...:||.||.||..
  Fly  1070 MSTEAFCATY--NIDLFVVVYSVIDRNTFAAA----ERVLQYLKENEMLLSRGAILVANKTDLQR 1128

  Fly   131 KRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIR 173
            .|.|.....:..|::.|..::|||:....|||::...::.:::
  Fly  1129 HRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVK 1171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 50/170 (29%)
CG42541NP_996345.3 RGK 1008..>1175 CDD:206715 50/170 (29%)
small_GTPase 1008..1171 CDD:197466 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.