DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and nras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_571220.2 Gene:nras / 30380 ZFINID:ZDB-GENE-990415-166 Length:188 Species:Danio rerio


Alignment Length:180 Identity:92/180 - (51%)
Similarity:130/180 - (72%) Gaps:3/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76
            :|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:|||||||||:|:|:|
Zfish     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68

  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141
            |.|.|:||||||||:|.:.:||.....:||||.|||:.:.:|.:||||||||  .|.|...:.|.
Zfish    69 DQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL--ARTVDTKQAQE 131

  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRC 191
            .|:.:.:.:||||||||:.|:..|:.|:||||..:.:...:...| |..|
Zfish   132 LARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDR-KQGC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 88/161 (55%)
nrasNP_571220.2 H_N_K_Ras_like 3..163 CDD:133338 87/160 (54%)
Effector region 32..40 4/7 (57%)
Hypervariable region. /evidence=ECO:0000250 165..184 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.