DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Hras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_006230597.3 Gene:Hras / 293621 RGDID:2827 Length:290 Species:Rattus norvegicus


Alignment Length:198 Identity:98/198 - (49%)
Similarity:136/198 - (68%) Gaps:8/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQ 69
            |......:|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:||||||||
  Rat    98 PVEAMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ 162

  Fly    70 EDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKV 134
            |:|:|:||.|.|:||||||||:|.:.:||:...::||||.|||:.:.:|.:|||||||| ..|.|
  Rat   163 EEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL-AARTV 226

  Fly   135 PLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTE--DSKATSGRAKDRCKKRRLK 197
            ...:.|..|:.:.:||:|||||||:.|:..|:.|:||||..|..  :....||.....|     |
  Rat   227 ESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSC-----K 286

  Fly   198 CTL 200
            |.|
  Rat   287 CVL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 89/161 (55%)
HrasXP_006230597.3 H_N_K_Ras_like 104..265 CDD:133338 88/161 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.