DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rit2

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001013078.1 Gene:Rit2 / 291713 RGDID:1307654 Length:217 Species:Rattus norvegicus


Alignment Length:199 Identity:80/199 - (40%)
Similarity:121/199 - (60%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQE 70
            :.|...:||:|:|:|||||||:|:||:..:|.:.::||..|:|:.:|.:|.|...:||||||||.
  Rat    15 SGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA 79

  Fly    71 DYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVP 135
            ::.|:|:.|.|.||||:..:|:||.:|||...:|:|.|.:|::...||.:|||||.||...|:|.
  Rat    80 EFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVS 144

  Fly   136 LSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIR---------SRKTEDSKATSGRAKDRC 191
            ..|....|:.:...:.||||..|..:|..|..|:||||         .||.:...:...:.|...
  Rat   145 TEEGMTLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASL 209

  Fly   192 KKRR 195
            ||:|
  Rat   210 KKKR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 73/170 (43%)
Rit2NP_001013078.1 Rit_Rin_Ric 19..190 CDD:206712 73/170 (43%)
small_GTPase 19..184 CDD:197466 73/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.