DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Mras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038936811.1 Gene:Mras / 25482 RGDID:3111 Length:236 Species:Rattus norvegicus


Alignment Length:205 Identity:91/205 - (44%)
Similarity:128/205 - (62%) Gaps:5/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDT 66
            |..|:.....:|:::||.|||||||||:||....||.||:||..|||.|...:|.:...:|:|||
  Rat    32 SAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDT 96

  Fly    67 AGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131
            ||||:::|:|:.|.|:|:|||.|:|:||..||:....|.:.|||||:.||.|.:||.||.||...
  Rat    97 AGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHL 161

  Fly   132 RKVPLSECQLRAQQWAVPYVETSAKTRE-NVDKVFFDLMREIRSRKTEDS----KATSGRAKDRC 191
            ||:...:.:..|.::.:||:|||||... ||||.|.||:|.||.:..|.:    |.|..|.....
  Rat   162 RKITRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRAT 226

  Fly   192 KKRRLKCTLL 201
            ...:|:|.:|
  Rat   227 GTHKLQCVIL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 81/162 (50%)
MrasXP_038936811.1 M_R_Ras_like 40..204 CDD:133345 80/163 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.