DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Kras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_017447932.1 Gene:Kras / 24525 RGDID:2981 Length:189 Species:Rattus norvegicus


Alignment Length:193 Identity:97/193 - (50%)
Similarity:138/193 - (71%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76
            :|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:|||||||||:|:|:|
  Rat     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68

  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141
            |.|.|:||||||||:|.:.:||:....:||||.|||:.|.:|.:|||||||| ..|.|...:.|.
  Rat    69 DQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQAQE 132

  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRS---RKTEDSKATSGRAKDRCKKRRLKCTLL 201
            .|:.:.:|::|||||||:.|:..|:.|:||||.   :|....:.|.|     |.|.: ||.::
  Rat   133 LARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPG-----CVKIK-KCVIM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 89/161 (55%)
KrasXP_017447932.1 H_N_K_Ras_like 3..164 CDD:133338 88/160 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.