Sequence 1: | NP_525063.1 | Gene: | Rala / 31332 | FlyBaseID: | FBgn0015286 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001078518.1 | Gene: | MRAS / 22808 | HGNCID: | 7227 | Length: | 208 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 92/205 - (44%) |
---|---|---|---|
Similarity: | 127/205 - (61%) | Gaps: | 5/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDT 66
Fly 67 AGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131
Fly 132 RKVPLSECQLRAQQWAVPYVETSAKTRE-NVDKVFFDLMREIRSRKTEDS----KATSGRAKDRC 191
Fly 192 KKRRLKCTLL 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rala | NP_525063.1 | RalA_RalB | 12..174 | CDD:206710 | 81/162 (50%) |
MRAS | NP_001078518.1 | M_R_Ras_like | 12..176 | CDD:133345 | 80/163 (49%) |
Effector region | 42..50 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0395 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1259506at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |