DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and MRAS

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001078518.1 Gene:MRAS / 22808 HGNCID:7227 Length:208 Species:Homo sapiens


Alignment Length:205 Identity:92/205 - (44%)
Similarity:127/205 - (61%) Gaps:5/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDT 66
            |..|:.....:|:::||.|||||||||:||....||.||:||..|||.|...:|.:...:|:|||
Human     4 SAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDT 68

  Fly    67 AGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131
            ||||:::|:|:.|.|:|:|||.|:|:||..||:....|.:.|||||:.||.|.:||.||.||...
Human    69 AGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHL 133

  Fly   132 RKVPLSECQLRAQQWAVPYVETSAKTRE-NVDKVFFDLMREIRSRKTEDS----KATSGRAKDRC 191
            ||:...:.:..|.:..:||:|||||... ||||.|.||:|.||.:..|.|    |.|..|.....
Human   134 RKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRAT 198

  Fly   192 KKRRLKCTLL 201
            ...:|:|.:|
Human   199 GTHKLQCVIL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 81/162 (50%)
MRASNP_001078518.1 M_R_Ras_like 12..176 CDD:133345 80/163 (49%)
Effector region 42..50 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.