DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rras

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_033127.1 Gene:Rras / 20130 MGIID:98179 Length:218 Species:Mus musculus


Alignment Length:203 Identity:91/203 - (44%)
Similarity:125/203 - (61%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA 67
            :.|..|.. ||:::||.|||||||||:||:...||.||:||..|||.|...:||...::||||||
Mouse    22 RDPPPGET-HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTA 85

  Fly    68 GQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKR 132
            |||::.|:|:.|.|:|.|||.||:|.|.:||....:...||||||:.:..|.:|||||.||.::|
Mouse    86 GQEEFGAMREQYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQR 150

  Fly   133 KVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED---SKATSGRAKD-RCKK 193
            :|..||....:....:.|.|.|||.|.|||:.|..|:|.:|..:.::   |..::.|.|| .|  
Mouse   151 QVLRSEASSFSASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGC-- 213

  Fly   194 RRLKCTLL 201
               .|.||
Mouse   214 ---PCVLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 80/161 (50%)
RrasNP_033127.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 2/8 (25%)
M_R_Ras_like 28..191 CDD:133345 80/163 (49%)
Effector region 58..66 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.