DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and ssr-2

DIOPT Version :10

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_508490.4 Gene:ssr-2 / 191965 WormBaseID:WBGene00006055 Length:335 Species:Caenorhabditis elegans


Alignment Length:84 Identity:18/84 - (21%)
Similarity:27/84 - (32%) Gaps:38/84 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PTTFE-------SSTESTDDPTP------DVTPVV--------------------FVQTTKVQEL 295
            |||.:       ||:.|:..|.|      |:..|:                    |:.   :|:.
 Worm   347 PTTIKKALNQSPSSSSSSLKPCPYRGFRRDIVSVIGNCAYRRKEVQDEIRERDGLFLM---LQQC 408

  Fly   296 TTQTSNGVPLLLSTAIWAI 314
            .|...|  |.|....:|.|
 Worm   409 VTDDEN--PFLREWGLWCI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710
ssr-2NP_508490.4 P-loop containing Nucleoside Triphosphate Hydrolases 22..178 CDD:476819
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.